Lineage for d1d2ma1 (1d2m A:2-409)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23655Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins)
  6. 23734Protein Nucleotide excision repair enzyme UvrB [52708] (2 species)
  7. 23740Species Thermus thermophilus [TaxId:274] [52709] (2 PDB entries)
  8. 23743Domain d1d2ma1: 1d2m A:2-409 [32417]

Details for d1d2ma1

PDB Entry: 1d2m (more details), 1.9 Å

PDB Description: uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme

SCOP Domain Sequences for d1d2ma1:

Sequence, based on SEQRES records: (download)

>d1d2ma1 c.37.1.13 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus}
tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
sttrslltrrdvivvasvsaiyglgdpreyrarnlvvergkpyprevllerllelgyqrn
didlspgrfrakgevleifpayetepirvelfgdeverisqvhpvtgerlrelpgfvlfp
athylspegleeilkeiekelwervryfeergevlyaqrlkertlydlemlrvmgtcpgv
enyaryftgkapgeppytlldyfpedflvfldeshvtvpqlqgmyrgdyarkktlvdygf
rlpsaldnrplrfeeflervsqvvfvsatpgpfelahsgrvveqiirp

Sequence, based on observed residues (ATOM records): (download)

>d1d2ma1 c.37.1.13 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus}
tfryrgpspkgdqpkaiaglvealrdgerfvtllgatgtgktvtmakviealgrpalvla
pnkilaaqlaaefrelfpenaveyfisyydyyqpeayvpgkdlyiekdasinpeierlrh
sttrslltrrdvivvasvsaiyglgdpreyrarnlvvrevllerllelgyqrndidlspg
rfrakgevleifpayetepirvelgfvlfpathylspegleeilkeiekelwervryfee
rgevlyaqrlkertlydlemlrvmgtcpgvenyaryftgkapgeppytlldyfpedflvf
ldeshvtvpqlqgmyrgdyarkktlvdygfrlpsaldnrplrfeeflervsqvvfvsatp
gpfelahsgrvveqiirp

SCOP Domain Coordinates for d1d2ma1:

Click to download the PDB-style file with coordinates for d1d2ma1.
(The format of our PDB-style files is described here.)

Timeline for d1d2ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d2ma2