Lineage for d5e93b_ (5e93 B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) 
Protein automated matches [190228] (20 species)
not a true protein
Species Trypanosoma cruzi [TaxId:353153] [324150] (2 PDB entries) 
Domain d5e93b_: 5e93 B: [324169]
automated match to d2djxa_
complexed with 5ll, cac, edo, fmn, gol, nco, peg
Details for d5e93b_
PDB Entry: 5e93 (more details), 1.41 Å
PDB Description: crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0071
PDB Compounds: (B:) Dihydroorotate dehydrogenase (fumarate)SCOPe Domain Sequences for d5e93b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e93b_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie
SCOPe Domain Coordinates for d5e93b_:
Click to download the PDB-style file with coordinates for d5e93b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5e93b_:
- d5e93b_ first appeared in SCOPe 2.06
- d5e93b_ appears in SCOPe 2.07
View in 3D
