Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (20 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [324150] (2 PDB entries) |
Domain d5e93b_: 5e93 B: [324169] automated match to d2djxa_ complexed with 5ll, cac, edo, fmn, gol, nco, peg |
PDB Entry: 5e93 (more details), 1.41 Å
SCOPe Domain Sequences for d5e93b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e93b_ c.1.4.1 (B:) automated matches {Trypanosoma cruzi [TaxId: 353153]} mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr tleefrgrvktie
Timeline for d5e93b_: