SCOPe 2.06: Domain d5f8vb_: 5f8v B:

Lineage for d5f8vb_ (5f8v B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [324159] (1 PDB entry)

8. Domain d5f8vb_: 5f8v B: [324165]
   automated match to d2c0ra_

Details for d5f8vb_

PDB Entry: 5f8v, 2.14 Å

PDB Description: crystal structure of plp bound phosphoserine aminotransferase (psat) from trichomonas vaginalis

PDB Compounds: (B:) Aminotransferase, class V family protein

SCOPe Domain Sequences for d5f8vb_:

Sequence; same for both SEQRES and ATOM records:

>d5f8vb_ c.67.1.0 (B:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
raynfsagpaavplecleraaaemtnwrnsgmsvievshrgkhwmeeqkeaterlrtllq
vpenfnilfvaggaslqfsaipfnfigehkavdylctgtwskkafdeckrlafpgvtvns
vagnppanpvevpardtwklsedaayfyycdnetiqgiefqqfpdvpapliidmssnfls
rpitqwekvgcifacaqknfglagmsvviirkdmlerpvkpfcpitmdyriqvknncmyn
tpptfaiyfanhifkwieekgglaamdalnkekakkvyeaidsnpnfvnrikpewrsrmn
mpffrpdgyenkdldadakfvnfctqrklltlkghvsvggfrascynacpmeavdalvqa
mkewpgf

Timeline for d5f8vb_:

• d5f8vb_ is new in SCOPe 2.06-stable
  
• d5f8vb_ appears in SCOPe 2.07
  
• d5f8vb_ appears in the current release, SCOPe 2.08