Lineage for d5ea9a_ (5ea9 A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) 
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) 
Protein automated matches [190228] (20 species)
not a true protein
Species Trypanosoma cruzi [TaxId:353153] [324150] (2 PDB entries) 
Domain d5ea9a_: 5ea9 A: [324151]
automated match to d2djxa_
complexed with 5lm, edo, fmn, gol, nco
Details for d5ea9a_
PDB Entry: 5ea9 (more details), 1.71 Å
PDB Description: crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with neq0130
PDB Compounds: (A:) Dihydroorotate dehydrogenase (fumarate)SCOPe Domain Sequences for d5ea9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ea9a_ c.1.4.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie
SCOPe Domain Coordinates for d5ea9a_:
Click to download the PDB-style file with coordinates for d5ea9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5ea9a_:
- d5ea9a_ first appeared in SCOPe 2.06
- d5ea9a_ appears in SCOPe 2.07
View in 3D
