Lineage for d1fuua1 (1fuu A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins) 
Protein Initiation factor 4a [52706] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries) 
Domain d1fuua1: 1fuu A: [32412]
Details for d1fuua1
PDB Entry: 1fuu (more details), 2.5 Å
PDB Description: yeast initiation factor 4a
SCOP Domain Sequences for d1fuua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fuua1 c.37.1.13 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
ppttqvvllsatmpndvlevttkfmrnpvrilvkk
SCOP Domain Coordinates for d1fuua1:
Click to download the PDB-style file with coordinates for d1fuua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fuua1:
- d1fuua1 appears in SCOP 1.57
- d1fuua1 appears in the current release, SCOPe 2.08, called d1fuua_
View in 3D
