SCOPe 2.06: Domain d4yqvb2: 4yqv B:103-241

Lineage for d4yqvb2 (4yqv B:103-241)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (42 PDB entries)

8. Domain d4yqvb2: 4yqv B:103-241 [324111]
   Other proteins in same PDB: d4yqva1, d4yqvb1, d4yqvc1
   automated match to d1eema1
   complexed with 4gg

Details for d4yqvb2

PDB Entry: 4yqv, 2.06 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor c4-10

PDB Compounds: (B:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d4yqvb2:

Sequence; same for both SEQRES and ATOM records:

>d4yqvb2 a.45.1.1 (B:103-241) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

Timeline for d4yqvb2:

• d4yqvb2 is new in SCOPe 2.06-stable
  
• d4yqvb2 appears in SCOPe 2.07
  
• d4yqvb2 appears in the current release, SCOPe 2.08