SCOPe 2.08: Domain d5grwa1: 5grw A:1-118

Lineage for d5grwa1 (5grw A:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5grwa1: 5grw A:1-118 [324105]
   automated match to d2gfbb1

Details for d5grwa1

PDB Entry: 5grw, 2.8 Å

PDB Description: crystal structure of homo-specific diabody

PDB Compounds: (A:) homo-specific diabody protein

SCOPe Domain Sequences for d5grwa1:

Sequence; same for both SEQRES and ATOM records:

>d5grwa1 b.1.1.0 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqlvesggglvqpggslrlscaasgftfrnsamhwvrqapgkglewvssiwysgsntyya
dsvkgrftisrdnskntlylqmnslfaedtavyycarfaggwgaydvwgqgtlvtvss

Timeline for d5grwa1:

• d5grwa1 first appeared in SCOPe 2.06
  
• d5grwa1 appears in SCOPe 2.07