Lineage for d1fuka_ (1fuk A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70353Protein Initiation factor 4a [52706] (1 species)
  7. 70354Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries)
  8. 70355Domain d1fuka_: 1fuk A: [32409]

Details for d1fuka_

PDB Entry: 1fuk (more details), 1.75 Å

PDB Description: crystal structure of the carboxy terminal domain of yeast eif4a

SCOP Domain Sequences for d1fuka_:

Sequence, based on SEQRES records: (download)

>d1fuka_ c.37.1.13 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
ikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysd
lpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggr
fgrkgvainfvtnedvgamrelekfystqieelpsdiatlln

Sequence, based on observed residues (ATOM records): (download)

>d1fuka_ c.37.1.13 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
ikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysd
lpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggg
vainfvtnedvgamrelekfystqieelpsdiatlln

SCOP Domain Coordinates for d1fuka_:

Click to download the PDB-style file with coordinates for d1fuka_.
(The format of our PDB-style files is described here.)

Timeline for d1fuka_: