SCOP 1.55: Domain d1hv8b2: 1hv8 B:211-365

Lineage for d1hv8b2 (1hv8 B:211-365)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins)

6. Protein Putative DEAD box RNA helicase [52704] (1 species)

7. Species Archaea (Methanococcus jannaschii) [TaxId:2190] [52705] (1 PDB entry)

8. Domain d1hv8b2: 1hv8 B:211-365 [32408]

Details for d1hv8b2

PDB Entry: 1hv8, 3 Å

PDB Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii

SCOP Domain Sequences for d1hv8b2:

Sequence; same for both SEQRES and ATOM records:

>d1hv8b2 c.37.1.13 (B:211-365) Putative DEAD box RNA helicase {Archaea (Methanococcus jannaschii)}
nanieqsyvevnenerfealcrllknkefyglvfcktkrdtkelasmlrdigfkagaihg
dlsqsqrekvirlfkqkkiriliatdvmsrgidvndlncvinyhlpqnpesymhrigrtg
ragkkgkaisiinrreykklryieramklkikklk

Timeline for d1hv8b2:

• d1hv8b2 appears in SCOP 1.57
  
• d1hv8b2 appears in the current release, SCOPe 2.08