Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) |
Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins) |
Protein Putative DEAD box RNA helicase [52704] (1 species) |
Species Archaea (Methanococcus jannaschii) [TaxId:2190] [52705] (1 PDB entry) |
Domain d1hv8b2: 1hv8 B:211-365 [32408] |
PDB Entry: 1hv8 (more details), 3 Å
SCOP Domain Sequences for d1hv8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv8b2 c.37.1.13 (B:211-365) Putative DEAD box RNA helicase {Archaea (Methanococcus jannaschii)} nanieqsyvevnenerfealcrllknkefyglvfcktkrdtkelasmlrdigfkagaihg dlsqsqrekvirlfkqkkiriliatdvmsrgidvndlncvinyhlpqnpesymhrigrtg ragkkgkaisiinrreykklryieramklkikklk
Timeline for d1hv8b2: