Lineage for d1hv8b1 (1hv8 B:3-210)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23655Family c.37.1.13: Extended AAA-ATPase domain [52700] (10 proteins)
  6. 23745Protein Putative DEAD box RNA helicase [52704] (1 species)
  7. 23746Species Archaea (Methanococcus jannaschii) [TaxId:2190] [52705] (1 PDB entry)
  8. 23749Domain d1hv8b1: 1hv8 B:3-210 [32407]

Details for d1hv8b1

PDB Entry: 1hv8 (more details), 3 Å

PDB Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii

SCOP Domain Sequences for d1hv8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv8b1 c.37.1.13 (B:3-210) Putative DEAD box RNA helicase {Archaea (Methanococcus jannaschii)}
veymnfnelnlsdnilnairnkgfekptdiqmkviplflndeynivaqartgsgktasfa
iplielvnenngieaiiltptrelaiqvadeieslkgnknlkiakiyggkaiypqikalk
nanivvgtpgrildhinrgtlnlknvkyfildeademlnmgfikdvekilnacnkdkril
lfsatmpreilnlakkymgdysfikaki

SCOP Domain Coordinates for d1hv8b1:

Click to download the PDB-style file with coordinates for d1hv8b1.
(The format of our PDB-style files is described here.)

Timeline for d1hv8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hv8b2