Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries) Uniprot P08263 |
Domain d5jcuc2: 5jcu C:81-222 [324019] Other proteins in same PDB: d5jcua1, d5jcub1, d5jcuc1, d5jcud1 automated match to d1k3ya1 complexed with edo, gvx |
PDB Entry: 5jcu (more details), 1.93 Å
SCOPe Domain Sequences for d5jcuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jcuc2 a.45.1.1 (C:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} lygkdikeralidmyiegiadlgemilllpvxppeekdaklalikekiknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkppmdeksleearkifrf
Timeline for d5jcuc2: