SCOPe 2.07: Domain d5klvb1: 5klv B:15-235

Lineage for d5klvb1 (5klv B:15-235)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (7 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [56000] (19 PDB entries)
   Uniprot P23004

8. Domain d5klvb1: 5klv B:15-235 [323993]
   Other proteins in same PDB: d5klva1, d5klva2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_, d5klvk_
   automated match to d1ntmb1
   complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvb1

PDB Entry: 5klv, 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited

PDB Compounds: (B:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOPe Domain Sequences for d5klvb1:

Sequence; same for both SEQRES and ATOM records:

>d5klvb1 d.185.1.1 (B:15-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus) [TaxId: 9913]}
agvpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlass
lttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrr
wevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdy
vqnhftsarmaliglgvshpvlkqvaeqflnirgglglsga

Timeline for d5klvb1:

• d5klvb1 first appeared in SCOPe 2.06
  
• d5klvb1 appears in the current release, SCOPe 2.08