Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [323882] (1 PDB entry) |
Domain d5an1e2: 5an1 E:86-219 [323980] Other proteins in same PDB: d5an1a1, d5an1b1, d5an1c1, d5an1d1, d5an1e1, d5an1f1, d5an1g1, d5an1h1 automated match to d3crta2 complexed with gsh |
PDB Entry: 5an1 (more details), 2 Å
SCOPe Domain Sequences for d5an1e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5an1e2 a.45.1.0 (E:86-219) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]} lcgttpeelvrtdmiecqltdmheafftvtyehyeqkdaytaslpaklrqysdflgsrpw fagdkltyidflayeifdqhlsldrtcldgfknlqafqkrfedleaikkymaspkflkkp icnkyaqftiiegk
Timeline for d5an1e2: