SCOPe 2.08: Domain d5jcwb1: 5jcw B:1-76

Lineage for d5jcwb1 (5jcw B:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (64 PDB entries)

8. Domain d5jcwb1: 5jcw B:1-76 [323963]
   Other proteins in same PDB: d5jcwa2, d5jcwb2
   automated match to d13gsa2
   complexed with act, ca, gsh, gvx, mpd

Details for d5jcwb1

PDB Entry: 5jcw, 1.95 Å

PDB Description: crystal structure of hgstp1-1 with glutathione adduct of phenethyl isothiocyanate

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d5jcwb1:

Sequence; same for both SEQRES and ATOM records:

>d5jcwb1 c.47.1.5 (B:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

Timeline for d5jcwb1:

• d5jcwb1 first appeared in SCOPe 2.06
  
• d5jcwb1 appears in SCOPe 2.07