Lineage for d5an1b1 (5an1 B:1-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880103Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [323880] (1 PDB entry)
  8. 2880105Domain d5an1b1: 5an1 B:1-85 [323907]
    Other proteins in same PDB: d5an1a2, d5an1b2, d5an1c2, d5an1d2, d5an1e2, d5an1f2, d5an1g2, d5an1h2
    automated match to d3crta1
    complexed with gsh

Details for d5an1b1

PDB Entry: 5an1 (more details), 2 Å

PDB Description: crystallographic structure of the glutathione s-transferase from litopenaeus vannamei complexed with glutathione
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d5an1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5an1b1 c.47.1.0 (B:1-85) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mlpvlgywktralcqpirlmlgytgtefeeknypvgdapdydksewlavkfklglafpnl
pyyidgdvkitqskaimrylarkhg

SCOPe Domain Coordinates for d5an1b1:

Click to download the PDB-style file with coordinates for d5an1b1.
(The format of our PDB-style files is described here.)

Timeline for d5an1b1: