Lineage for d5dvha_ (5dvh A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385622Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2385751Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2385752Protein automated matches [190445] (8 species)
    not a true protein
  7. 2385808Species Potato (Solanum tuberosum) [TaxId:4113] [226410] (9 PDB entries)
  8. 2385812Domain d5dvha_: 5dvh A: [323906]
    automated match to d3tc2b_
    complexed with cl

Details for d5dvha_

PDB Entry: 5dvh (more details), 1.8 Å

PDB Description: structure of the kunitz-type cysteine protease inhibitor pcpi-3 from potato
PDB Compounds: (A:) pcpi-3

SCOPe Domain Sequences for d5dvha_:

Sequence, based on SEQRES records: (download)

>d5dvha_ b.42.4.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
vsppvldmdgeplkideeysiisipfgggsvylanlgntkcpngvvqdssggnnnktpvl
fytmklgshfvsenqdvsikfstsssskscinetvwkvaysivgpthsplrfvitggtfg
fpgpnnienwfkiekyetgrphsyklrycpsqyicptcqfdcadvglyenkgyarlalnn
kpypfgfskvnkn

Sequence, based on observed residues (ATOM records): (download)

>d5dvha_ b.42.4.0 (A:) automated matches {Potato (Solanum tuberosum) [TaxId: 4113]}
vsppvldmdgeplkideeysiisipfgggsvylanlgntkcpngvvqdssnktpvlfytm
klgshfvsenqdvsikfstkscinetvwkvaysivgpthsplrfvitggtfgfpgpnnie
nwfkiekyetgrphsyklrycpsqyicptcqfdcadvglyenkgyarlalnnkpypfgfs
kvnkn

SCOPe Domain Coordinates for d5dvha_:

Click to download the PDB-style file with coordinates for d5dvha_.
(The format of our PDB-style files is described here.)

Timeline for d5dvha_: