Lineage for d1e3mb2 (1e3m B:567-800)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870122Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
    missing some secondary structures that made up less than one-third of the common domain
  6. 2870217Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 2870218Species Escherichia coli [TaxId:562] [52699] (8 PDB entries)
    Uniprot P23909 2-800
  8. 2870229Domain d1e3mb2: 1e3m B:567-800 [32390]
    Other proteins in same PDB: d1e3ma1, d1e3ma3, d1e3ma4, d1e3mb1, d1e3mb3, d1e3mb4
    complexed with adp, mg

Details for d1e3mb2

PDB Entry: 1e3m (more details), 2.2 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:t mismatch
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1e3mb2:

Sequence, based on SEQRES records: (download)

>d1e3mb2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1e3mb2 c.37.1.12 (B:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgtfmvemtetanilhnateyslvlmdeig
rgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdti
afmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOPe Domain Coordinates for d1e3mb2:

Click to download the PDB-style file with coordinates for d1e3mb2.
(The format of our PDB-style files is described here.)

Timeline for d1e3mb2: