Lineage for d1e3ma2 (1e3m A:567-800)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989641Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 989703Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 989704Species Escherichia coli [TaxId:562] [52699] (10 PDB entries)
    Uniprot P23909 2-800
  8. 989708Domain d1e3ma2: 1e3m A:567-800 [32389]
    Other proteins in same PDB: d1e3ma1, d1e3ma3, d1e3ma4, d1e3mb1, d1e3mb3, d1e3mb4
    complexed with adp, mg

Details for d1e3ma2

PDB Entry: 1e3m (more details), 2.2 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:t mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1e3ma2:

Sequence, based on SEQRES records: (download)

>d1e3ma2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records): (download)

>d1e3ma2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgfmvemtetanilhnateyslvlmdeigr
gtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtia
fmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

SCOPe Domain Coordinates for d1e3ma2:

Click to download the PDB-style file with coordinates for d1e3ma2.
(The format of our PDB-style files is described here.)

Timeline for d1e3ma2: