SCOPe 2.08: Domain d1e3ma2: 1e3m A:567-800

Lineage for d1e3ma2 (1e3m A:567-800)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
   there are two additional subdomains inserted into the central core that has a RecA-like topology
   missing some secondary structures that made up less than one-third of the common domain
   

6. Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)

7. Species Escherichia coli [TaxId:562] [52699] (8 PDB entries)
   Uniprot P23909 2-800

8. Domain d1e3ma2: 1e3m A:567-800 [32389]
   Other proteins in same PDB: d1e3ma1, d1e3ma3, d1e3ma4, d1e3mb1, d1e3mb3, d1e3mb4
   complexed with adp, mg

Details for d1e3ma2

PDB Entry: 1e3m, 2.2 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:t mismatch

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1e3ma2:

Sequence, based on SEQRES records:

>d1e3ma2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgaaddlasgrstfmvemtetanilhnate
yslvlmdeigrgtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvh
ldalehgdtiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Sequence, based on observed residues (ATOM records):

>d1e3ma2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
talialmayigsyvpaqkveigpidriftrvgfmvemtetanilhnateyslvlmdeigr
gtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgdtia
fmhsvqdgaasksyglavaalagvpkevikrarqklrelesis

Timeline for d1e3ma2:

• d1e3ma2 first appeared (with stable ids) in SCOP 1.55
  
• d1e3ma2 appears in SCOPe 2.07