Lineage for d1ewra2 (1ewr A:542-765)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1848535Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 1848604Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 1848621Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 1848628Domain d1ewra2: 1ewr A:542-765 [32387]
    Other proteins in same PDB: d1ewra1, d1ewra3, d1ewrb1, d1ewrb3

Details for d1ewra2

PDB Entry: 1ewr (more details), 3.19 Å

PDB Description: crystal structure of taq muts
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ewra2:

Sequence, based on SEQRES records: (download)

>d1ewra2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar

Sequence, based on observed residues (ATOM records): (download)

>d1ewra2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqamaar

SCOPe Domain Coordinates for d1ewra2:

Click to download the PDB-style file with coordinates for d1ewra2.
(The format of our PDB-style files is described here.)

Timeline for d1ewra2: