Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries) |
Domain d1fw6b2: 1fw6 B:1542-1762 [32386] Other proteins in same PDB: d1fw6a1, d1fw6a3, d1fw6a4, d1fw6b1, d1fw6b3, d1fw6b4 protein/DNA complex; complexed with adp, mg, so4 |
PDB Entry: 1fw6 (more details), 2.7 Å
SCOPe Domain Sequences for d1fw6b2:
Sequence, based on SEQRES records: (download)
>d1fw6b2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg lvfyhqvlpgpasksygvevaamaglpkevvararallqam
>d1fw6b2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq vlpgpasksygvevaamaglpkevvararallqam
Timeline for d1fw6b2:
View in 3D Domains from other chains: (mouse over for more information) d1fw6a1, d1fw6a2, d1fw6a3, d1fw6a4 |