Lineage for d1fw6b2 (1fw6 B:1542-1762)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 989641Family c.37.1.12: ABC transporter ATPase domain-like [52686] (24 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 989703Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 989722Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 989726Domain d1fw6b2: 1fw6 B:1542-1762 [32386]
    Other proteins in same PDB: d1fw6a1, d1fw6a3, d1fw6a4, d1fw6b1, d1fw6b3, d1fw6b4
    protein/DNA complex; complexed with adp, mg, so4

Details for d1fw6b2

PDB Entry: 1fw6 (more details), 2.7 Å

PDB Description: crystal structure of a taq muts-dna-adp ternary complex
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1fw6b2:

Sequence, based on SEQRES records: (download)

>d1fw6b2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqam

Sequence, based on observed residues (ATOM records): (download)

>d1fw6b2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqam

SCOPe Domain Coordinates for d1fw6b2:

Click to download the PDB-style file with coordinates for d1fw6b2.
(The format of our PDB-style files is described here.)

Timeline for d1fw6b2: