Lineage for d1fw6a2 (1fw6 A:542-765)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 831595Family c.37.1.12: ABC transporter ATPase domain-like [52686] (23 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 831646Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 831665Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 831668Domain d1fw6a2: 1fw6 A:542-765 [32385]
    Other proteins in same PDB: d1fw6a1, d1fw6a3, d1fw6a4, d1fw6b1, d1fw6b3, d1fw6b4

Details for d1fw6a2

PDB Entry: 1fw6 (more details), 2.7 Å

PDB Description: crystal structure of a taq muts-dna-adp ternary complex
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1fw6a2:

Sequence, based on SEQRES records: (download)

>d1fw6a2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqamaar

Sequence, based on observed residues (ATOM records): (download)

>d1fw6a2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqamaar

SCOP Domain Coordinates for d1fw6a2:

Click to download the PDB-style file with coordinates for d1fw6a2.
(The format of our PDB-style files is described here.)

Timeline for d1fw6a2: