Lineage for d1ewqb2 (1ewq B:1542-1762)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697205Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 697256Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species)
  7. 697275Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries)
  8. 697277Domain d1ewqb2: 1ewq B:1542-1762 [32384]
    Other proteins in same PDB: d1ewqa1, d1ewqa3, d1ewqa4, d1ewqb1, d1ewqb3, d1ewqb4
    CASP4
    complexed with edo, so4

Details for d1ewqb2

PDB Entry: 1ewq (more details), 2.2 Å

PDB Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution
PDB Compounds: (B:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1ewqb2:

Sequence, based on SEQRES records: (download)

>d1ewqb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqam

Sequence, based on observed residues (ATOM records): (download)

>d1ewqb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqam

SCOP Domain Coordinates for d1ewqb2:

Click to download the PDB-style file with coordinates for d1ewqb2.
(The format of our PDB-style files is described here.)

Timeline for d1ewqb2: