| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
| Protein DNA repair protein MutS, the C-terminal domain [52697] (2 species) |
| Species Thermus aquaticus [TaxId:271] [52698] (4 PDB entries) |
| Domain d1ewqb2: 1ewq B:1542-1762 [32384] Other proteins in same PDB: d1ewqa1, d1ewqa3, d1ewqa4, d1ewqb1, d1ewqb3, d1ewqb4 CASP4 protein/DNA complex; complexed with edo, so4 |
PDB Entry: 1ewq (more details), 2.2 Å
SCOPe Domain Sequences for d1ewqb2:
Sequence, based on SEQRES records: (download)
>d1ewqb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvll
devgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagg
lvfyhqvlpgpasksygvevaamaglpkevvararallqam
>d1ewqb2 c.37.1.12 (B:1542-1762) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
yvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalial
laqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrg
tssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhq
vlpgpasksygvevaamaglpkevvararallqam
Timeline for d1ewqb2:
View in 3DDomains from other chains: (mouse over for more information) d1ewqa1, d1ewqa2, d1ewqa3, d1ewqa4 |