Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (6 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein automated matches [232361] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232384] (6 PDB entries) |
Domain d5sx5n1: 5sx5 N:311-480 [323796] Other proteins in same PDB: d5sx5h1, d5sx5h2, d5sx5j1, d5sx5j2, d5sx5k1, d5sx5k2, d5sx5l1, d5sx5l2, d5sx5m2, d5sx5m3, d5sx5m4, d5sx5n2, d5sx5n3 automated match to d3p0ya1 complexed with 1pe, edo, gol, so4; mutant |
PDB Entry: 5sx5 (more details), 2.5 Å
SCOPe Domain Sequences for d5sx5n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5sx5n1 c.10.2.5 (N:311-480) automated matches {Human (Homo sapiens) [TaxId: 9606]} kvcngigigefkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslglrslk eisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgq
Timeline for d5sx5n1: