Lineage for d5sx5n1 (5sx5 N:311-480)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851793Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2851844Protein automated matches [232361] (1 species)
    not a true protein
  7. 2851845Species Human (Homo sapiens) [TaxId:9606] [232384] (6 PDB entries)
  8. 2851860Domain d5sx5n1: 5sx5 N:311-480 [323796]
    Other proteins in same PDB: d5sx5h1, d5sx5h2, d5sx5j1, d5sx5j2, d5sx5k1, d5sx5k2, d5sx5l1, d5sx5l2, d5sx5m2, d5sx5m3, d5sx5m4, d5sx5n2, d5sx5n3
    automated match to d3p0ya1
    complexed with 1pe, edo, gol, so4; mutant

Details for d5sx5n1

PDB Entry: 5sx5 (more details), 2.5 Å

PDB Description: crystal structure of panitumumab in complex with epidermal growth factor receptor domain 3 mutant s468r.
PDB Compounds: (N:) Epidermal growth factor receptor

SCOPe Domain Sequences for d5sx5n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sx5n1 c.10.2.5 (N:311-480) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kvcngigigefkdslsidatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldi
lktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslditslglrslk
eisdgdviisgnknlcyantinwkklfgtsgqktkiirnrgensckatgq

SCOPe Domain Coordinates for d5sx5n1:

Click to download the PDB-style file with coordinates for d5sx5n1.
(The format of our PDB-style files is described here.)

Timeline for d5sx5n1: