SCOPe 2.06: Domain d5tevb_: 5tev B:

Lineage for d5tevb_ (5tev B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:242231] [323751] (2 PDB entries)

8. Domain d5tevb_: 5tev B: [323756]
   automated match to d3prha_

Details for d5tevb_

PDB Entry: 5tev, 2.25 Å

PDB Description: crystal structure of a tryptophanyl-trna synthetase from neisseria gonorrhoeae, apo

PDB Compounds: (B:) Tryptophan--tRNA ligase

SCOPe Domain Sequences for d5tevb_:

Sequence; same for both SEQRES and ATOM records:

>d5tevb_ c.26.1.0 (B:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
skkrvltgvtttgtphlgnyvgairpavraaqnpdtesflfladyhgiikcheqemihqs
tqavaatwlacgldperttfyrqsdipevmelnwiltcitakglmnrahaykaavqanae
ngqedpdfgvemglfsypilmtadilmfnanevpvgrdqiqhvemardiagrfnhrfqel
ftlpevkidenvellvgldgrkmsksygntiplwendkktqksvnkiitnmkepgepkqp
desplfeiykafstpsetaeftqmladglawgeakklsaakinaelaelrerynaltsnp
sqieeilqagaqkarkearelldkvrdavgirplk

Timeline for d5tevb_:

• d5tevb_ is new in SCOPe 2.06-stable
  
• d5tevb_ appears in SCOPe 2.07
  
• d5tevb_ appears in the current release, SCOPe 2.08