Lineage for d1f2u.1 (1f2u A:,B:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 697205Family c.37.1.12: ABC transporter ATPase domain-like [52686] (20 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 697367Protein Rad50 [52691] (1 species)
  7. 697368Species Archaeon Pyrococcus furiosus [TaxId:2261] [52692] (4 PDB entries)
  8. 697370Domain d1f2u.1: 1f2u A:,B: [32374]

Details for d1f2u.1

PDB Entry: 1f2u (more details), 1.6 Å

PDB Description: crystal structure of rad50 abc-atpase
PDB Compounds: (A:) rad50 abc-ATPase, (B:) rad50 abc-ATPase

SCOP Domain Sequences for d1f2u.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1f2u.1 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplrikdikkde
ftkvgardtyidlifekdgtkyritrrflkgyssgeihamkrlvgnewkhvtepsskais
afmeklipyniflnaiyirqgqidailesXalareaalskigelaseifaeftegkysev
vvraeenkvrlfvvwegkerpltflsggerialglafrlamslylageisllildeptpy
ldeerrrklitimerylkkipqvilvshdeelkdaadhvirislengsskvevvs

SCOP Domain Coordinates for d1f2u.1:

Click to download the PDB-style file with coordinates for d1f2u.1.
(The format of our PDB-style files is described here.)

Timeline for d1f2u.1: