Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.1: Monellin [54404] (2 proteins) |
Protein automated matches [190339] (1 species) not a true protein |
Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [187163] (15 PDB entries) |
Domain d5lc6b_: 5lc6 B: [323730] automated match to d1iv7a_ complexed with so4; mutant |
PDB Entry: 5lc6 (more details), 1.7 Å
SCOPe Domain Sequences for d5lc6b_:
Sequence, based on SEQRES records: (download)
>d5lc6b_ d.17.1.1 (B:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlgkfavdeenkigkygrltfnkvirpsmkktiyenegfreikgyey qlyvrasdklfradisedyktrgrkllrfngpvppp
>d5lc6b_ d.17.1.1 (B:) automated matches {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]} geweiidigpftqnlgkfavdeenkigkygrltfnkvirpsmkktiyeikgyeyqlyvra sdklfradisedyktrgrkllrfngpvppp
Timeline for d5lc6b_: