SCOPe 2.06: Domain d5jxia1: 5jxi A:109-442

Lineage for d5jxia1 (5jxi A:109-442)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein automated matches [190073] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [238473] (7 PDB entries)

8. Domain d5jxia1: 5jxi A:109-442 [323706]
   Other proteins in same PDB: d5jxia2, d5jxia3
   automated match to d1p8ja2
   complexed with ca, cl, na

Details for d5jxia1

PDB Entry: 5jxi, 2 Å

PDB Description: structure of the unliganded form of the proprotein convertase furin in presence of edta.

PDB Compounds: (A:) Furin

SCOPe Domain Sequences for d5jxia1:

Sequence; same for both SEQRES and ATOM records:

>d5jxia1 c.41.1.1 (A:109-442) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vyqeptdpkfpqqwylsgvtqrdlnvkaawaqgytghgivvsilddgieknhpdlagnyd
pgasfdvndqdpdpqprytqmndnrhgtrcagevaavanngvcgvgvaynariggvrmld
gevtdavearslglnpnhihiysaswgpeddgktvdgparlaeeaffrgvsqgrgglgsi
fvwasgnggrehdscncdgytnsiytlsissatqfgnvpwyseacsstlattyssgnqne
kqivttdlrqkcteshtgtsasaplaagiialtleanknltwrdmqhlvvqtskpahlna
ndwatngvgrkvshsygyglldagamvalaqnwt

Timeline for d5jxia1:

• d5jxia1 is new in SCOPe 2.06-stable
  
• d5jxia1 appears in SCOPe 2.07
  
• d5jxia1 appears in the current release, SCOPe 2.08