SCOPe 2.03: Domain d1g64a_: 1g64 A:

Lineage for d1g64a_ (1g64 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein ATP:corrinoid adenosyltransferase CobA [52684] (1 species)
   lacks the two last strands

7. Species Salmonella typhimurium [TaxId:90371] [52685] (3 PDB entries)

8. Domain d1g64a_: 1g64 A: [32368]
   complexed with atp, b12, mg

Details for d1g64a_

PDB Entry: 1g64, 2.1 Å

PDB Description: the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex

PDB Compounds: (A:) cob(I)alamin adenosyltransferase

SCOPe Domain Sequences for d1g64a_:

Sequence; same for both SEQRES and ATOM records:

>d1g64a_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]}
rgiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqvm
atgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisal
narpghqtviitgrgchrdildladtvselrpvkhafdagvkaqmgidy

Timeline for d1g64a_:

• d1g64a_ first appeared (with stable ids) in SCOP 1.55
  
• d1g64a_ appears in SCOPe 2.02
  
• d1g64a_ appears in SCOPe 2.04
  
• d1g64a_ appears in the current release, SCOPe 2.08