Lineage for d1g64a_ (1g64 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122391Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 122400Protein ATP:corrinoid adenosyltransferase CobA [52684] (1 species)
  7. 122401Species Salmonella typhimurium [TaxId:90371] [52685] (3 PDB entries)
  8. 122404Domain d1g64a_: 1g64 A: [32368]

Details for d1g64a_

PDB Entry: 1g64 (more details), 2.1 Å

PDB Description: the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. cobalamin/atp ternary complex

SCOP Domain Sequences for d1g64a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g64a_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium}
rgiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqvm
atgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisal
narpghqtviitgrgchrdildladtvselrpvkhafdagvkaqmgidy

SCOP Domain Coordinates for d1g64a_:

Click to download the PDB-style file with coordinates for d1g64a_.
(The format of our PDB-style files is described here.)

Timeline for d1g64a_: