Lineage for d1g5ra_ (1g5r A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 179964Protein ATP:corrinoid adenosyltransferase CobA [52684] (1 species)
  7. 179965Species Salmonella typhimurium [TaxId:90371] [52685] (3 PDB entries)
  8. 179967Domain d1g5ra_: 1g5r A: [32367]

Details for d1g5ra_

PDB Entry: 1g5r (more details), 2.1 Å

PDB Description: the three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo form

SCOP Domain Sequences for d1g5ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ra_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium}
ergiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqv
matgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisa
lnarpghqtviitgrgchrdildladtvselrpvkha

SCOP Domain Coordinates for d1g5ra_:

Click to download the PDB-style file with coordinates for d1g5ra_.
(The format of our PDB-style files is described here.)

Timeline for d1g5ra_: