Lineage for d5ijvc2 (5ijv C:108-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355291Species Cow (Bos taurus) [TaxId:9913] [226022] (15 PDB entries)
  8. 2355310Domain d5ijvc2: 5ijv C:108-211 [323662]
    automated match to d4k3dl2

Details for d5ijvc2

PDB Entry: 5ijv (more details), 2.2 Å

PDB Description: crystal structure of bovine fab e03
PDB Compounds: (C:) bovine Fab E03 light chain

SCOPe Domain Sequences for d5ijvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ijvc2 b.1.1.0 (C:108-211) automated matches {Cow (Bos taurus) [TaxId: 9913]}
qpksppsvtlfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskq
snskyaassylsltssdwkskgsyscevthegstvtktvkpsec

SCOPe Domain Coordinates for d5ijvc2:

Click to download the PDB-style file with coordinates for d5ijvc2.
(The format of our PDB-style files is described here.)

Timeline for d5ijvc2: