Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein ATP:corrinoid adenosyltransferase CobA [52684] (1 species) lacks the two last strands |
Species Salmonella typhimurium [TaxId:90371] [52685] (3 PDB entries) |
Domain d1g5ta_: 1g5t A: [32366] complexed with atp, mg |
PDB Entry: 1g5t (more details), 1.8 Å
SCOPe Domain Sequences for d1g5ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} ergiiivftgngkgkttaafgtaaravghgknvgvvqfikgtwpngernllephgvefqv matgftwetqnreadtaacmavwqhgkrmladplldmvvldeltymvaydylpleevisa lnarpghqtviitgrgchrdildladtvselrpvkha
Timeline for d1g5ta_: