Class a: All alpha proteins [46456] (290 folds) |
Fold a.242: Dcp2 domain-like [140585] (1 superfamily) 4 helices; orthogonal array of two alpha hairpins |
Superfamily a.242.1: Dcp2 domain-like [140586] (2 families) automatically mapped to Pfam PF05026 |
Family a.242.1.0: automated matches [323645] (1 protein) not a true family |
Protein automated matches [323646] (1 species) not a true protein |
Species Schizosaccharomyces pombe [TaxId:284812] [323647] (2 PDB entries) |
Domain d5kq1e1: 5kq1 E:1-94 [323652] Other proteins in same PDB: d5kq1b2, d5kq1b3, d5kq1e2, d5kq1e3 automated match to d2a6ta1 protein/RNA complex |
PDB Entry: 5kq1 (more details), 3 Å
SCOPe Domain Sequences for d5kq1e1:
Sequence, based on SEQRES records: (download)
>d5kq1e1 a.242.1.0 (E:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg lrvfsaklfahcpllwkwskvheeafddflrykt
>d5kq1e1 a.242.1.0 (E:1-94) automated matches {Schizosaccharomyces pombe [TaxId: 284812]} msftnatfsqvlddlsarfilnlpaeeqssverlcfqieqahwfyedfiraqndqlpslg lrvfsaklfahcpllwkwskvhafddflrykt
Timeline for d5kq1e1: