![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species) |
![]() | Species Bacillus sp., strain ps3 [TaxId:1409] [88777] (1 PDB entry) |
![]() | Domain d1skyb3: 1sky B:96-371 [32358] Other proteins in same PDB: d1skyb1, d1skyb2, d1skye1, d1skye2, d1skye3 complexed with so4 |
PDB Entry: 1sky (more details), 3.2 Å
SCOPe Domain Sequences for d1skyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1skyb3 c.37.1.11 (B:96-371) Central domain of alpha subunit of F1 ATP synthase {Bacillus sp., strain ps3 [TaxId: 1409]} evpvgetligrvvnplgqpvdglgpvettetrpiesrapgvmdrrsvheplqtgikaida lvpigrgqreliigdrqtgktsvaidtiinqkdqnmiciyvaigqkestvatvvetlakh gapdytivvtasasqpapllflapyagvamgeyfmimgkhvlvviddlskqaaayrqlsl llrrppgreaypgdifylhsrlleraaklsdakgggsltalpfvetqagdisayiptnvi sitdgqiflqsdlffsgvrpainaglsvsrvggaaq
Timeline for d1skyb3: