Lineage for d1skyb3 (1sky B:96-371)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314141Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 314194Protein Central domain of alpha subunit of F1 ATP synthase [88774] (4 species)
  7. 314195Species Bacillus sp., strain ps3 [TaxId:1409] [88777] (1 PDB entry)
  8. 314196Domain d1skyb3: 1sky B:96-371 [32358]
    Other proteins in same PDB: d1skyb1, d1skyb2, d1skye1, d1skye2, d1skye3
    complexed with so4

Details for d1skyb3

PDB Entry: 1sky (more details)

PDB Description: crystal structure of the nucleotide free alpha3beta3 sub-complex of f1-atpase from the thermophilic bacillus ps3

SCOP Domain Sequences for d1skyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1skyb3 c.37.1.11 (B:96-371) Central domain of alpha subunit of F1 ATP synthase {Bacillus sp., strain ps3}
evpvgetligrvvnplgqpvdglgpvettetrpiesrapgvmdrrsvheplqtgikaida
lvpigrgqreliigdrqtgktsvaidtiinqkdqnmiciyvaigqkestvatvvetlakh
gapdytivvtasasqpapllflapyagvamgeyfmimgkhvlvviddlskqaaayrqlsl
llrrppgreaypgdifylhsrlleraaklsdakgggsltalpfvetqagdisayiptnvi
sitdgqiflqsdlffsgvrpainaglsvsrvggaaq

SCOP Domain Coordinates for d1skyb3:

Click to download the PDB-style file with coordinates for d1skyb3.
(The format of our PDB-style files is described here.)

Timeline for d1skyb3: