Class b: All beta proteins [48724] (177 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) automatically mapped to Pfam PF00194 |
Protein automated matches [190681] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187805] (29 PDB entries) |
Domain d5e2na_: 5e2n A: [323571] automated match to d3d0na_ complexed with cit, edo, peg, v14, zn |
PDB Entry: 5e2n (more details), 1.53 Å
SCOPe Domain Sequences for d5e2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e2na_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} swgyrehngpihwkeffpiadgdqqspieiktkevkydsslrplsikydpssakiisnsg hsfnvdfddtenksvlrggpltgsyrlrqvhlhwgsaddhgsehivdgvsyaaelhvvhw nsdkypsfveaahepdglavlgvflqigepnsqlqkitdtldsikekgkqtrftnfdlls llppswdywtypgsltvppllesvtwivlkqpinissqqlakfrsllctaegeaaaflvs nhrppqplkgrkvrasfh
Timeline for d5e2na_: