Lineage for d1mabb3 (1mab B:82-357)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1847928Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 1848038Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 1848105Species Norway rat (Rattus norvegicus) [TaxId:10116] [88781] (1 PDB entry)
  8. 1848106Domain d1mabb3: 1mab B:82-357 [32357]
    Other proteins in same PDB: d1maba1, d1maba2, d1maba3, d1mabb1, d1mabb2, d1mabg_
    complexed with adp, atp, mg, po4

Details for d1mabb3

PDB Entry: 1mab (more details), 2.8 Å

PDB Description: rat liver f1-atpase
PDB Compounds: (B:) protein (f1-ATPase beta chain)

SCOPe Domain Sequences for d1mabb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mabb3 c.37.1.11 (B:82-357) Central domain of beta subunit of F1 ATP synthase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ikipvgpetlgrimnvigepidergpiktkqfapihaeapefiemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOPe Domain Coordinates for d1mabb3:

Click to download the PDB-style file with coordinates for d1mabb3.
(The format of our PDB-style files is described here.)

Timeline for d1mabb3: