Lineage for d5apbb_ (5apb B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249472Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2249473Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2249559Family e.23.1.0: automated matches [191594] (1 protein)
    not a true family
  6. 2249560Protein automated matches [191083] (23 species)
    not a true protein
  7. 2249693Species Streptomyces sp. [TaxId:1931] [256140] (7 PDB entries)
  8. 2249700Domain d5apbb_: 5apb B: [323567]
    automated match to d3dhva_
    complexed with amp, atp, mg, thr

Details for d5apbb_

PDB Entry: 5apb (more details), 2.4 Å

PDB Description: structure of the adenylation domain thr1 involved in the biosynthesis of 4-chlorothreonine in streptomyces sp. oh-5093, ligand bound structure
PDB Compounds: (B:) adenylation domain

SCOPe Domain Sequences for d5apbb_:

Sequence, based on SEQRES records: (download)

>d5apbb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1931]}
efgatlvdlfsraamempdrtalhiddekisygllhswaegladllhdagvrkgdrvalr
mppganaiaamlgilragaayvpldirnpparnafivtdsqvvalvgdpgdipeytgplv
teenvaalrdreaikdpgperpgpqdvayiiytsgttgrpkgvpvrhgnvtalfeacsrl
fsfsaddrwllfhsmafdfsvweiwgalstgaelvvlpywtartpvetarvvrdrgitvl
nqtptafgalttavlgegidlpelryvvfggekltpavvrpwakrfgldrphlinmygit
ettvhatfhrlteddlaaedsvigrplpgfthrivtedgrdaatgepgelwlagpqvseg
ylnrpeltaerfttgpardggapppryyhsgdlvsrraggdlvyqgradlqvklrghrie
lsdveaavrthpavvdavvwvhefapgdsrlvcaytaqaseegtgpdaralrahvktvlp
symqpsqylalpelprtingkadrasvarafderr

Sequence, based on observed residues (ATOM records): (download)

>d5apbb_ e.23.1.0 (B:) automated matches {Streptomyces sp. [TaxId: 1931]}
efgatlvdlfsraamempdrtalhiddekisygllhswaegladllhdagvrkgdrvalr
mppganaiaamlgilragaayvpldirnpparnafivtdsqvvalvgdpgdipgplvtee
nvaalrdreaigperpgpqdvayiiytsgttgrpkgvpvrhgnvtalfeacsrlfsfsad
drwllfhsmafdfsvweiwgalstgaelvvlpywtartpvetarvvrdrgitvlnqtpta
fgalttavlgegidlpelryvvfggekltpavvrpwakrfgldrphlinmygitettvha
tfhrlteddlaaedsvigrplpgfthrivtedgrdaatgepgelwlagpqvsegylnrpe
ltaerfttgggapppryyhsgdlvsrraggdlvyqgradlqvklrghrielsdveaavrt
hpavvdavvwvhefapgdsrlvcaytaqagpdaralrahvktvlpsymqpsqylalpelp
rtingkadrasvarafderr

SCOPe Domain Coordinates for d5apbb_:

Click to download the PDB-style file with coordinates for d5apbb_.
(The format of our PDB-style files is described here.)

Timeline for d5apbb_:

  • d5apbb_ appears in periodic updates to SCOPe 2.06 starting on 2016-10-07
  • d5apbb_ became obsolete in SCOPe 2.07