Lineage for d1cowf3 (1cow F:82-357)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 180008Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 180012Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 180066Domain d1cowf3: 1cow F:82-357 [32355]
    Other proteins in same PDB: d1cowa1, d1cowa2, d1cowb1, d1cowb2, d1cowc1, d1cowc2, d1cowd1, d1cowd2, d1cowe1, d1cowe2, d1cowf1, d1cowf2, d1cowg_

Details for d1cowf3

PDB Entry: 1cow (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with aurovertin b

SCOP Domain Sequences for d1cowf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cowf3 c.37.1.11 (F:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1cowf3:

Click to download the PDB-style file with coordinates for d1cowf3.
(The format of our PDB-style files is described here.)

Timeline for d1cowf3: