Lineage for d5dyma_ (5dym A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (66 species)
    not a true protein
  7. 2280238Species Peptoclostridium difficile [TaxId:645463] [323539] (1 PDB entry)
  8. 2280239Domain d5dyma_: 5dym A: [323540]
    automated match to d1xmaa_

Details for d5dyma_

PDB Entry: 5dym (more details), 1.89 Å

PDB Description: crystal structure of a padr family transcription regulator from hypervirulent clostridium difficile r20291 - cdpadr_0991 to 1.89 angstrom resolution
PDB Compounds: (A:) PadR-family transcriptional regulator

SCOPe Domain Sequences for d5dyma_:

Sequence, based on SEQRES records: (download)

>d5dyma_ a.4.5.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 645463]}
gyidilivsilekkdcygyeiakqvrersefelkegtmylalkrmesknliksyysneqs
sggrrkyynltnegkdfleikkqewrfikkvmnqflg

Sequence, based on observed residues (ATOM records): (download)

>d5dyma_ a.4.5.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 645463]}
gyidilivsilekkdcygyeiakqvrerseflkegtmylalkrmesknliksyysneqss
ggrrkyynltnegkdfleikkqewrfikkvmnqflg

SCOPe Domain Coordinates for d5dyma_:

Click to download the PDB-style file with coordinates for d5dyma_.
(The format of our PDB-style files is described here.)

Timeline for d5dyma_:

  • d5dyma_ appears in periodic updates to SCOPe 2.06 starting on 2016-10-07