Lineage for d5dcha_ (5dch A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880208Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189148] (7 PDB entries)
  8. 2880210Domain d5dcha_: 5dch A: [323538]
    automated match to d4zl8a_
    complexed with 1yo, gol, mes

Details for d5dcha_

PDB Entry: 5dch (more details), 1.45 Å

PDB Description: crystal structure of pseudomonas aeruginosa dsba e82i in complex with mips-0000851 (3-[(2-methylbenzyl)sulfanyl]-4h-1,2,4-triazol-4-amine)
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d5dcha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dcha_ c.47.1.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
dytagkeyvelsspvpvsqpgkievvelfwygcphcyafeptivpwseklpadvhfvrlp
alfggiwnvhgqmfltlismgvehdvhnavfeaihkehkklatpeemadflagkgvdkek
flstynsfaikgqmekakklamayqvtgvptmvvngkyrfdigsaggpeetlkladylie
keraaak

SCOPe Domain Coordinates for d5dcha_:

Click to download the PDB-style file with coordinates for d5dcha_.
(The format of our PDB-style files is described here.)

Timeline for d5dcha_: