![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88780] (14 PDB entries) Uniprot P00829 |
![]() | Domain d1cowd3: 1cow D:82-357 [32353] Other proteins in same PDB: d1cowa1, d1cowa2, d1cowa3, d1cowb1, d1cowb2, d1cowb3, d1cowc1, d1cowc2, d1cowc3, d1cowd1, d1cowd2, d1cowe1, d1cowe2, d1cowf1, d1cowf2, d1cowg_ complexed with adp, anp, aur, mg |
PDB Entry: 1cow (more details), 3.1 Å
SCOPe Domain Sequences for d1cowd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cowd3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1cowd3: