Lineage for d1efrf3 (1efr F:82-357)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70095Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (6 proteins)
  6. 70110Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 70114Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 70156Domain d1efrf3: 1efr F:82-357 [32349]
    Other proteins in same PDB: d1efra1, d1efra2, d1efrb1, d1efrb2, d1efrc1, d1efrc2, d1efrd1, d1efrd2, d1efre1, d1efre2, d1efrf1, d1efrf2, d1efrg_

Details for d1efrf3

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

SCOP Domain Sequences for d1efrf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efrf3 c.37.1.11 (F:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1efrf3:

Click to download the PDB-style file with coordinates for d1efrf3.
(The format of our PDB-style files is described here.)

Timeline for d1efrf3: