Lineage for d5dpta_ (5dpt A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178753Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)
  8. 2178854Domain d5dpta_: 5dpt A: [323484]
    automated match to d3wanb_
    complexed with mpd

Details for d5dpta_

PDB Entry: 5dpt (more details), 2.9 Å

PDB Description: crystal structure of plekhm1 lir-fused human gabarapl1_2-117
PDB Compounds: (A:) Pleckstrin homology domain-containing family M member 1, Gamma-aminobutyric acid receptor-associated protein-like 1,Gamma-aminobutyric acid receptor-associated protein-like 1

SCOPe Domain Sequences for d5dpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dpta_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
edewvnvgskfqykedhpfeyrkkegekirkkypdrvpvivekapkarvpdldkrkylvp
sdltvgqfyflirkrihlrpedalfffvnntipptsatmgqlyednheedyflyvaysde
sv

SCOPe Domain Coordinates for d5dpta_:

Click to download the PDB-style file with coordinates for d5dpta_.
(The format of our PDB-style files is described here.)

Timeline for d5dpta_: