Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (11 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88780] (10 PDB entries) |
Domain d1e1qe3: 1e1q E:82-357 [32342] Other proteins in same PDB: d1e1qa1, d1e1qa2, d1e1qa3, d1e1qb1, d1e1qb2, d1e1qb3, d1e1qc1, d1e1qc2, d1e1qc3, d1e1qd1, d1e1qd2, d1e1qe1, d1e1qe2, d1e1qf1, d1e1qf2, d1e1qg_ |
PDB Entry: 1e1q (more details), 2.61 Å
SCOP Domain Sequences for d1e1qe3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1qe3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)} iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa pattfahldattvlsraiaelgiypavdpldstsri
Timeline for d1e1qe3: