Lineage for d1nbmd3 (1nbm D:82-357)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 180008Protein Central domain of alpha and beta subunits of F1 ATP synthase [52678] (4 species)
  7. 180012Species Cow (Bos taurus) [TaxId:9913] [52679] (9 PDB entries)
  8. 180046Domain d1nbmd3: 1nbm D:82-357 [32335]
    Other proteins in same PDB: d1nbma1, d1nbma2, d1nbmb1, d1nbmb2, d1nbmc1, d1nbmc2, d1nbmd1, d1nbmd2, d1nbme1, d1nbme2, d1nbmf1, d1nbmf2, d1nbmg_

Details for d1nbmd3

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbmd3 c.37.1.11 (D:82-357) Central domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1nbmd3:

Click to download the PDB-style file with coordinates for d1nbmd3.
(The format of our PDB-style files is described here.)

Timeline for d1nbmd3: