SCOPe 2.08: Domain d5iusb1: 5ius B:30-146

Lineage for d5iusb1 (5ius B:30-146)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [256383] (17 PDB entries)

8. Domain d5iusb1: 5ius B:30-146 [323347]
   Other proteins in same PDB: d5iusa2, d5iusb2
   automated match to d3rrqa_
   complexed with cl; mutant

Details for d5iusb1

PDB Entry: 5ius, 2.89 Å

PDB Description: crystal structure of human pd-l1 in complex with high affinity pd-1 mutant

PDB Compounds: (B:) Programmed cell death protein 1

SCOPe Domain Sequences for d5iusb1:

Sequence, based on SEQRES records:

>d5iusb1 b.1.1.1 (B:30-146) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rpwnpptfspallvvtegdnatftcsfsntsesfhvvwhrespsgqtdtlaafpedrsqp
gqdarfrvtqlpngrdfhmsvvrarrndsgtyvcgvislapkiqikeslraelrvte

Sequence, based on observed residues (ATOM records):

>d5iusb1 b.1.1.1 (B:30-146) Programmed cell death protein 1, PD1, extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
rpwnpptfspallvvtegdnatftcsfsntsesfhvvwhrespsgqtdtlaafpedpgqd
arfrvtqlpngrdfhmsvvrarrndsgtyvcgvislapkiqikeslraelrvte

Timeline for d5iusb1:

• d5iusb1 first appeared in SCOPe 2.06
  
• d5iusb1 appears in SCOPe 2.07